PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00034111-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 595aa    MW: 66148 Da    PI: 4.9651
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00034111-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2062.1e-633665711208
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+ lL++cA+av+++d++ a+++L++++++as +gd +qRla yf+ +L arl++s+ +l+ +l++  ts    +e l+a++l+  + P+ k+
  PSME_00034111-RA 366 LRALLVHCAQAVATDDTRGANEILKQIRQHASAYGDGTQRLANYFADGLVARLSGSGGRLFTTLSSGLTS---AAEILKAYQLLLVAYPYRKM 455
                       5789************************************************************999999...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       sh+++ q++l+ +e+++r+Hi+Df+i +G+QWp+L+q La+Rp+gpp+lRiTg++ p++g   +e++eetg+rLa++A+++gvpfe+++ +a+
  PSME_00034111-RA 456 SHFLTYQTVLNVAEKSTRLHIVDFGILYGFQWPSLIQCLANRPGGPPMLRITGIDYPQPGfrAAERIEETGRRLADYAKSFGVPFEYHA-IAT 547
                       ***********************************************************9*9***************************.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvl 208
                       ++e+l++eeL+++++E+l+ ++  
  PSME_00034111-RA 548 KWENLDVEELSLRSDEVLVASFWP 571
                       ******************987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.046340595IPR005202Transcription factor GRAS
PfamPF035147.2E-61366571IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MRISATMADK KTAIFYSNNM NGGSNNIGFQ RPWLQQETAM PATQFRGSLS SEKSIITSEG  60
ESEDTEVYSD IVLKYISDML MDENMEDKKC MYQECSALQA TVKPFYDILG ENYPPQGLCN  120
SNIVGENQNL SLNYYEEDVQ NKIEDSSWIG DFFNSQIPSG FESPLSANIT AGYSSQYSFS  180
SSGSSTVIDG LPDSPIYELS LSELFSEGKE GLGVGEFEEA VQVAPKRNIG HSVENGWHFR  240
ARKKESDLDL QVGKREDAIG VAFQSNAAHS EDENGPKRQK DPHREDLDLE DRQSNKLSAV  300
YSDNVIRTES FDKILLCSGN GRVFLDLQLE ILQNGVQKSV QSESVKGLQG SKARGRKQGK  360
REVVDLRALL VHCAQAVATD DTRGANEILK QIRQHASAYG DGTQRLANYF ADGLVARLSG  420
SGGRLFTTLS SGLTSAAEIL KAYQLLLVAY PYRKMSHFLT YQTVLNVAEK STRLHIVDFG  480
ILYGFQWPSL IQCLANRPGG PPMLRITGID YPQPGFRAAE RIEETGRRLA DYAKSFGVPF  540
EYHAIATKWE NLDVEELSLR SDEVLVASFW PSSSGTAKEI DRALWKESFA VRTRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-313705698207GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA3E2G20.0A3E2G2_PINRA; SCARECROW-like protein 1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.13e-98GRAS family protein